PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca60574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 416aa    MW: 47021.8 Da    PI: 8.7027
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca60574.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.4e-49261521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 + pGfrF+Ptdeel+ +yLkkk++g +  + evi++vdi+k+ePwdLp k++ ++++ew+fFs+r kky++g++++rat+ gyWkatgk+++v+s +++
  Dca60574.1  26 MFPGFRFSPTDEELILYYLKKKLDGFDKCV-EVIPQVDICKFEPWDLPaKSIISSDQEWFFFSPRGKKYPNGSQSKRATEIGYWKATGKERAVKS-GSN 122
                 579***********************9777.99***************777788999*************************************9.99* PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++g+k+tLvf+ grapkge+t+W+mhey +
  Dca60574.1 123 VIGTKRTLVFHIGRAPKGERTEWIMHEYCM 152
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-5718168IPR003441NAC domain
PROSITE profilePS5100553.44526168IPR003441NAC domain
PfamPF023658.6E-2528151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MRDAEGEKMK GVVTKEAEIS IAASSMFPGF RFSPTDEELI LYYLKKKLDG FDKCVEVIPQ  60
VDICKFEPWD LPAKSIISSD QEWFFFSPRG KKYPNGSQSK RATEIGYWKA TGKERAVKSG  120
SNVIGTKRTL VFHIGRAPKG ERTEWIMHEY CMIGKGQDAL VVCRLRRKCD YHAIDEPSSE  180
ILLPNNSLTM MGSSGTNSGC LEPASTTPGY KTAESSLKKS SSSHDSHSVE QMDSASQSDW  240
KFKDEILQPE SSSHAKRCND EDDLFAEILN DNIVQLEECP PTSRDDASPI VDTTTMTTTT  300
VSIVPRQNRQ PNHPHMMQSY PSQGTANRRI RLRKLRRVSP RKEEIEKHMG ENVITNPKLG  360
RFWRVSILRG PMRLRVDGNR VFVLIVVMSL LILFISYVVT TPMFFLAMRI PPSLGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-452516816165NAC domain-containing protein 19
4dul_A4e-452516816165NAC domain-containing protein 19
1ut7_B4e-452516816165NO APICAL MERISTEM PROTEIN
1ut7_A4e-452516816165NO APICAL MERISTEM PROTEIN
1ut4_B4e-452516816165NO APICAL MERISTEM PROTEIN
1ut4_A4e-452516816165NO APICAL MERISTEM PROTEIN
3swp_D4e-452516819168NAC domain-containing protein 19
3swp_C4e-452516819168NAC domain-containing protein 19
3swp_B4e-452516819168NAC domain-containing protein 19
3swp_A4e-452516819168NAC domain-containing protein 19
3swm_D4e-452516819168NAC domain-containing protein 19
3swm_C4e-452516819168NAC domain-containing protein 19
3swm_B4e-452516819168NAC domain-containing protein 19
3swm_A4e-452516819168NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1327333RRIRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692710.11e-152PREDICTED: NAC domain-containing protein 89-like isoform X1
TrEMBLA0A0K9RI701e-160A0A0K9RI70_SPIOL; Uncharacterized protein
STRINGVIT_06s0080g00970.t011e-111(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.17e-80NTM1-like 8